PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Phvul.005G153200.1
Common NamePHAVU_005G153200g
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Phaseoleae; Phaseolus
Family FAR1
Protein Properties Length: 289aa    MW: 32404.5 Da    PI: 8.7735
Description FAR1 family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Phvul.005G153200.1genomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1FAR189.26e-28124211291
                FAR1   2 fYneYAkevGFsvrkskskkskrngeitkrtfvCskegkreeekkktekerrtraetrtgCkaklkvkkekdgkwevtkleleHnHelap 91 
                         fYn+YA++vGF +r+sk ++s+r+g+ + r +vC++eg+r ++k++  k  r+raetr+gC+a++ v+k ++gkw+vtk+ +eH H+l+p
  Phvul.005G153200.1 124 FYNAYATRVGFIIRVSKLSRSRRDGSAIGRALVCNREGYRMPDKRE--KIVRQRAETRVGCRAMILVRKVSSGKWVVTKFIQEHAHPLTP 211
                         ******************************************9988..9**************************************986 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PfamPF031012.7E-25124211IPR004330FAR1 DNA binding domain
Sequence ? help Back to Top
Protein Sequence    Length: 289 aa     Download sequence    Send to blast
MNLLSLHGTQ KHKSKFSQSR SLPTTIEFAS ASILMEFGID GSINGETVGN VTVGQINCCS  60
TADENKVGCS SFNPAYKHDH DDNITQDSSG GDTIPSGIPA VSVVSADEPY VGQEFDSEAA  120
AHAFYNAYAT RVGFIIRVSK LSRSRRDGSA IGRALVCNRE GYRMPDKREK IVRQRAETRV  180
GCRAMILVRK VSSGKWVVTK FIQEHAHPLT PGKGRRDCIY EQYPNEHDKI RELSQQLAIE  240
KKRSATYKRH LELIFEHIEE HNESLSKKIQ HIVERVKEME TKEQQSQR*
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAP0150400.0AP015040.1 Vigna angularis var. angularis DNA, chromosome 7, almost complete sequence, cultivar: Shumari.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_007150433.10.0hypothetical protein PHAVU_005G153200g
TrEMBLV7BWP30.0V7BWP3_PHAVU; Uncharacterized protein
STRINGGLYMA15G03440.11e-174(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF24533072
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G59470.24e-87FAR1 family protein